SCOPe 2.02: Domain d2fo9a_: 2fo9 A:

Lineage for d2fo9a_ (2fo9 A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (116 PDB entries)

8. Domain d2fo9a_: 2fo9 A: [133874]
   automated match to d1b0ea_
   complexed with acn, ca, so4

Details for d2fo9a_

PDB Entry: 2fo9, 2 Å

PDB Description: structure of porcine pancreatic elastase in 95% acetone

PDB Compounds: (A:) Elastase-1

SCOPe Domain Sequences for d2fo9a_:

Sequence; same for both SEQRES and ATOM records:

>d2fo9a_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d2fo9a_:

• d2fo9a_ first appeared in SCOP 1.73, called d2fo9a1
  
• d2fo9a_ appears in SCOPe 2.01
  
• d2fo9a_ appears in SCOPe 2.03
  
• d2fo9a_ appears in the current release, SCOPe 2.08