Lineage for d2fo9a1 (2fo9 A:16-255)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670617Protein Elastase [50536] (4 species)
  7. 670625Species Pig (Sus scrofa) [TaxId:9823] [50538] (91 PDB entries)
  8. 670688Domain d2fo9a1: 2fo9 A:16-255 [133874]
    automatically matched to d1esb__
    complexed with acn, ca, so4

Details for d2fo9a1

PDB Entry: 2fo9 (more details), 2 Å

PDB Description: structure of porcine pancreatic elastase in 95% acetone
PDB Compounds: (A:) Elastase-1

SCOP Domain Sequences for d2fo9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fo9a1 b.47.1.2 (A:16-255) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOP Domain Coordinates for d2fo9a1:

Click to download the PDB-style file with coordinates for d2fo9a1.
(The format of our PDB-style files is described here.)

Timeline for d2fo9a1: