![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Elastase [50536] (4 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [50538] (123 PDB entries) |
![]() | Domain d2fo9a_: 2fo9 A: [133874] automated match to d1b0ea_ complexed with acn, ca, so4 |
PDB Entry: 2fo9 (more details), 2 Å
SCOPe Domain Sequences for d2fo9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fo9a_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
Timeline for d2fo9a_: