SCOPe 2.06: Domain d2fo4b_: 2fo4 B:

Lineage for d2fo4b_ (2fo4 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (182 PDB entries)
   Uniprot P01887

8. Domain d2fo4b_: 2fo4 B: [133871]
   Other proteins in same PDB: d2fo4a1, d2fo4a2
   automated match to d1bz9b_
   complexed with mpd, nag, po4

Details for d2fo4b_

PDB Entry: 2fo4, 2.7 Å

PDB Description: enhanced mhc class i binding and immune responses through anchor modification of the non-canonical tumor associated muc1-8 peptide

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d2fo4b_:

Sequence; same for both SEQRES and ATOM records:

>d2fo4b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d2fo4b_:

• d2fo4b_ first appeared in SCOP 1.73, called d2fo4b1
  
• d2fo4b_ appears in SCOPe 2.05
  
• d2fo4b_ appears in SCOPe 2.07
  
• d2fo4b_ appears in the current release, SCOPe 2.08