SCOPe 2.05: Domain d2fo4a2: 2fo4 A:3-180

Lineage for d2fo4a2 (2fo4 A:3-180)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (20 PDB entries)

8. Domain d2fo4a2: 2fo4 A:3-180 [133870]
   Other proteins in same PDB: d2fo4a1, d2fo4b_
   automatically matched to d1ddha2
   complexed with mpd, nag, po4

Details for d2fo4a2

PDB Entry: 2fo4, 2.7 Å

PDB Description: enhanced mhc class i binding and immune responses through anchor modification of the non-canonical tumor associated muc1-8 peptide

PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d2fo4a2:

Sequence; same for both SEQRES and ATOM records:

>d2fo4a2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeywer
etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd
yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll

Timeline for d2fo4a2:

• d2fo4a2 first appeared in SCOP 1.73
  
• d2fo4a2 appears in SCOPe 2.04
  
• d2fo4a2 appears in SCOPe 2.06
  
• d2fo4a2 appears in the current release, SCOPe 2.08