Lineage for d2fo4a2 (2fo4 A:3-180)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938064Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)
  8. 2938081Domain d2fo4a2: 2fo4 A:3-180 [133870]
    Other proteins in same PDB: d2fo4a1, d2fo4b_
    automatically matched to d1ddha2
    complexed with mpd, nag, po4

Details for d2fo4a2

PDB Entry: 2fo4 (more details), 2.7 Å

PDB Description: enhanced mhc class i binding and immune responses through anchor modification of the non-canonical tumor associated muc1-8 peptide
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d2fo4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fo4a2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeywer
etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd
yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll

SCOPe Domain Coordinates for d2fo4a2:

Click to download the PDB-style file with coordinates for d2fo4a2.
(The format of our PDB-style files is described here.)

Timeline for d2fo4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fo4a1
View in 3D
Domains from other chains:
(mouse over for more information)
d2fo4b_