Lineage for d2fo3a1 (2fo3 A:9-117)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2183823Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2183828Protein Putative ubiquitin-conjugating enzyme, E2 domain [143070] (1 species)
  7. 2183829Species Plasmodium chabaudi [TaxId:5825] [143071] (1 PDB entry)
    Uniprot Q4Y037 88-196
  8. 2183830Domain d2fo3a1: 2fo3 A:9-117 [133868]

Details for d2fo3a1

PDB Entry: 2fo3 (more details), 1.86 Å

PDB Description: plasmodium vivax ubiquitin conjugating enzyme e2
PDB Compounds: (A:) Ubiquitin-conjugating enzyme

SCOPe Domain Sequences for d2fo3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]}
yriqkelhnflnnppinctldvhpnniriwivkyvglentiyanevyklkiifpddyplk
ppivyflqkppkhthvysngdiclsllgddynpslsisglvlsiismls

SCOPe Domain Coordinates for d2fo3a1:

Click to download the PDB-style file with coordinates for d2fo3a1.
(The format of our PDB-style files is described here.)

Timeline for d2fo3a1: