![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Putative ubiquitin-conjugating enzyme, E2 domain [143070] (1 species) |
![]() | Species Plasmodium chabaudi [TaxId:5825] [143071] (1 PDB entry) Uniprot Q4Y037 88-196 |
![]() | Domain d2fo3a1: 2fo3 A:9-117 [133868] |
PDB Entry: 2fo3 (more details), 1.86 Å
SCOPe Domain Sequences for d2fo3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} yriqkelhnflnnppinctldvhpnniriwivkyvglentiyanevyklkiifpddyplk ppivyflqkppkhthvysngdiclsllgddynpslsisglvlsiismls
Timeline for d2fo3a1: