Lineage for d2fo1a3 (2fo1 A:381-541)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 951553Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 952083Superfamily b.42.7: DNA-binding protein LAG-1 (CSL) [110217] (1 family) (S)
    contains rudiment hairpin triplet lacking one hairpin
  5. 952084Family b.42.7.1: DNA-binding protein LAG-1 (CSL) [110218] (1 protein)
  6. 952085Protein DNA-binding protein LAG-1 (CSL) [110219] (1 species)
  7. 952086Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110220] (4 PDB entries)
    Uniprot Q9TYY1 195-660
  8. 952090Domain d2fo1a3: 2fo1 A:381-541 [133867]
    Other proteins in same PDB: d2fo1a1, d2fo1a2, d2fo1d1, d2fo1e1
    automatically matched to d1ttua3
    protein/DNA complex

Details for d2fo1a3

PDB Entry: 2fo1 (more details), 3.12 Å

PDB Description: Crystal Structure of the CSL-Notch-Mastermind ternary complex bound to DNA
PDB Compounds: (A:) Lin-12 and glp-1 phenotype protein 1, isoform b

SCOPe Domain Sequences for d2fo1a3:

Sequence, based on SEQRES records: (download)

>d2fo1a3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfdderglqetd
nfavrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqm
idnelvylclshdkiiqhqatainehrhqindgaawtiist

Sequence, based on observed residues (ATOM records): (download)

>d2fo1a3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfddednfavrd
gfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqmidnelv
ylclshdkiiqhqatainehrhqindgaawtiist

SCOPe Domain Coordinates for d2fo1a3:

Click to download the PDB-style file with coordinates for d2fo1a3.
(The format of our PDB-style files is described here.)

Timeline for d2fo1a3: