![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.7: DNA-binding protein LAG-1 (CSL) [110217] (1 family) ![]() contains rudiment hairpin triplet lacking one hairpin |
![]() | Family b.42.7.1: DNA-binding protein LAG-1 (CSL) [110218] (1 protein) |
![]() | Protein DNA-binding protein LAG-1 (CSL) [110219] (1 species) |
![]() | Species Caenorhabditis elegans [TaxId:6239] [110220] (2 PDB entries) |
![]() | Domain d2fo1a3: 2fo1 A:381-541 [133867] Other proteins in same PDB: d2fo1a1, d2fo1a2 automatically matched to d1ttua3 |
PDB Entry: 2fo1 (more details), 3.12 Å
SCOP Domain Sequences for d2fo1a3:
Sequence, based on SEQRES records: (download)
>d2fo1a3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]} ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfdderglqetd nfavrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqm idnelvylclshdkiiqhqatainehrhqindgaawtiist
>d2fo1a3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]} ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfddednfavrd gfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqmidnelv ylclshdkiiqhqatainehrhqindgaawtiist
Timeline for d2fo1a3: