SCOP 1.75: Domain d2fo0a3: 2fo0 A:241-530

Lineage for d2fo0a3 (2fo0 A:241-530)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Abelsone tyrosine kinase (abl) [56166] (1 species)
   PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase

7. Species Mouse (Mus musculus) [TaxId:10090] [56167] (9 PDB entries)

8. Domain d2fo0a3: 2fo0 A:241-530 [133864]
   Other proteins in same PDB: d2fo0a1, d2fo0a2
   automatically matched to d1opla3
   complexed with gol, myr, p16; mutant

Details for d2fo0a3

PDB Entry: 2fo0, 2.27 Å

PDB Description: organization of the sh3-sh2 unit in active and inactive forms of the c-abl tyrosine kinase

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1 (1B ISOFORM)

SCOP Domain Sequences for d2fo0a3:

Sequence; same for both SEQRES and ATOM records:

>d2fo0a3 d.144.1.7 (A:241-530) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
kptvygvspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeve
eflkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvll
ymatqissameylekknfihrnlaarnclvgenhlvkvadfglsrlmtgdtytahagakf
pikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerp
egcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg

Timeline for d2fo0a3:

• d2fo0a3 first appeared in SCOP 1.73
  
• d2fo0a3 appears in SCOPe 2.01
  
• d2fo0a3 appears in the current release, SCOPe 2.08