Lineage for d2fo0a3 (2fo0 A:241-530)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734725Protein Abelsone tyrosine kinase (abl) [56166] (1 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. 734726Species Mouse (Mus musculus) [TaxId:10090] [56167] (8 PDB entries)
  8. 734732Domain d2fo0a3: 2fo0 A:241-530 [133864]
    Other proteins in same PDB: d2fo0a1, d2fo0a2
    automatically matched to d1opla3
    complexed with gol, myr, p16; mutant

Details for d2fo0a3

PDB Entry: 2fo0 (more details), 2.27 Å

PDB Description: organization of the sh3-sh2 unit in active and inactive forms of the c-abl tyrosine kinase
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1 (1B ISOFORM)

SCOP Domain Sequences for d2fo0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fo0a3 d.144.1.7 (A:241-530) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
kptvygvspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeve
eflkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvll
ymatqissameylekknfihrnlaarnclvgenhlvkvadfglsrlmtgdtytahagakf
pikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerp
egcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg

SCOP Domain Coordinates for d2fo0a3:

Click to download the PDB-style file with coordinates for d2fo0a3.
(The format of our PDB-style files is described here.)

Timeline for d2fo0a3: