SCOPe 2.05: Domain d2fo0a2: 2fo0 A:139-239

Lineage for d2fo0a2 (2fo0 A:139-239)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Proto-oncogen tyrosine kinase [55573] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55574] (2 PDB entries)

8. Domain d2fo0a2: 2fo0 A:139-239 [133863]
   Other proteins in same PDB: d2fo0a1, d2fo0a3
   automated match to d2fo0a2
   complexed with gol, myr, p16

Details for d2fo0a2

PDB Entry: 2fo0, 2.27 Å

PDB Description: organization of the sh3-sh2 unit in active and inactive forms of the c-abl tyrosine kinase

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1 (1B ISOFORM)

SCOPe Domain Sequences for d2fo0a2:

Sequence; same for both SEQRES and ATOM records:

>d2fo0a2 d.93.1.1 (A:139-239) Proto-oncogen tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
nslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrinta
sdgklyvssesrfntlaelvhhhstvadglittlhypapkr

Timeline for d2fo0a2:

• d2fo0a2 first appeared in SCOP 1.73
  
• d2fo0a2 appears in SCOPe 2.04
  
• d2fo0a2 appears in SCOPe 2.06
  
• d2fo0a2 appears in the current release, SCOPe 2.08