Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Abl tyrosine kinase, SH3 domain [50052] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50054] (6 PDB entries) |
Domain d2fo0a1: 2fo0 A:65-138 [133862] Other proteins in same PDB: d2fo0a2, d2fo0a3 automated match to d2fo0a1 complexed with gol, myr, p16 |
PDB Entry: 2fo0 (more details), 2.27 Å
SCOPe Domain Sequences for d2fo0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fo0a1 b.34.2.1 (A:65-138) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} arwnskenllagpsendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtk ngqgwvpsnyitpv
Timeline for d2fo0a1: