Lineage for d2fo0a1 (2fo0 A:76-138)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665103Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 665104Family b.34.2.1: SH3-domain [50045] (38 proteins)
  6. 665108Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)
  7. 665109Species Human (Homo sapiens) [TaxId:9606] [50054] (5 PDB entries)
  8. 665114Domain d2fo0a1: 2fo0 A:76-138 [133862]
    Other proteins in same PDB: d2fo0a2, d2fo0a3
    automatically matched to d2abl_1
    complexed with gol, myr, p16; mutant

Details for d2fo0a1

PDB Entry: 2fo0 (more details), 2.27 Å

PDB Description: organization of the sh3-sh2 unit in active and inactive forms of the c-abl tyrosine kinase
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1 (1B ISOFORM)

SCOP Domain Sequences for d2fo0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fo0a1 b.34.2.1 (A:76-138) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
gpsendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyi
tpv

SCOP Domain Coordinates for d2fo0a1:

Click to download the PDB-style file with coordinates for d2fo0a1.
(The format of our PDB-style files is described here.)

Timeline for d2fo0a1: