Lineage for d2fnub_ (2fnu B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1866757Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 1867056Protein Spore coat polysaccharide biosynthesis protein C [142672] (1 species)
  7. 1867057Species Helicobacter pylori [TaxId:210] [142673] (3 PDB entries)
    Uniprot O25130 2-372
  8. 1867059Domain d2fnub_: 2fnu B: [133832]
    automated match to d2fn6a1
    complexed with pmp, ud1

Details for d2fnub_

PDB Entry: 2fnu (more details), 1.5 Å

PDB Description: PseC aminotransferase with external aldimine
PDB Compounds: (B:) aminotransferase

SCOPe Domain Sequences for d2fnub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnub_ c.67.1.4 (B:) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]}
mkefaysepcldkedkkavlevlnskqltqgkrsllfeealceflgvkhalvfnsatsal
ltlyrnfsefsadrneiittpisfvatanmllesgytpvfagikndgnidelalekline
rtkaivsvdyagksvevesvqklckkhslsflsdsshalgseyqnkkvggfalasvfsfh
aikpittaeggavvtndselhekmklfrshgmlkkdffegevksighnfrlneiqsalgl
sqlkkapflmqkreeaaltydrifkdnpyftplhpllkdkssnhlypilmhqkfftckkl
ileslhkrgilaqvhykpiyqyqlyqqlfntaplksaedfyhaeislpchanlnlesvqn
iahsvlktfesfki

SCOPe Domain Coordinates for d2fnub_:

Click to download the PDB-style file with coordinates for d2fnub_.
(The format of our PDB-style files is described here.)

Timeline for d2fnub_: