Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.67: PLP-dependent transferases [53382] (1 superfamily) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) |
Family c.67.1.4: GABA-aminotransferase-like [53417] (16 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
Protein Spore coat polysaccharide biosynthesis protein C [142672] (1 species) |
Species Helicobacter pylori [TaxId:210] [142673] (3 PDB entries) |
Domain d2fnub1: 2fnu B:2-372 [133832] automatically matched to 2FN6 A:2-372 complexed with pmp, ud1 |
PDB Entry: 2fnu (more details), 1.5 Å
SCOP Domain Sequences for d2fnub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fnub1 c.67.1.4 (B:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} kefaysepcldkedkkavlevlnskqltqgkrsllfeealceflgvkhalvfnsatsall tlyrnfsefsadrneiittpisfvatanmllesgytpvfagikndgnidelalekliner tkaivsvdyagksvevesvqklckkhslsflsdsshalgseyqnkkvggfalasvfsfha ikpittaeggavvtndselhekmklfrshgmlkkdffegevksighnfrlneiqsalgls qlkkapflmqkreeaaltydrifkdnpyftplhpllkdkssnhlypilmhqkfftckkli leslhkrgilaqvhykpiyqyqlyqqlfntaplksaedfyhaeislpchanlnlesvqni ahsvlktfesf
Timeline for d2fnub1: