SCOPe 2.02: Domain d2fnta_: 2fnt A:

Lineage for d2fnta_ (2fnt A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (7 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (413 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d2fnta_: 2fnt A: [133829]
   automated match to d1mt7a_
   complexed with act, po4

Details for d2fnta_

PDB Entry: 2fnt, 1.44 Å

PDB Description: crystal structure of a drug-resistant (v82a) inactive (d25n) hiv-1 protease complexed with ap2v variant of hiv-1 nc-p1 substrate.

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d2fnta_:

Sequence; same for both SEQRES and ATOM records:

>d2fnta_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpaniigrnlltqigctlnf

Timeline for d2fnta_:

• d2fnta_ first appeared in SCOP 1.73, called d2fnta1
  
• d2fnta_ appears in SCOPe 2.01
  
• d2fnta_ appears in SCOPe 2.03
  
• d2fnta_ appears in the current release, SCOPe 2.08