SCOPe 2.08: Domain d2fnpa1: 2fnp A:103-224

Lineage for d2fnpa1 (2fnp A:103-224)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Pleiotropic regulator of virulence genes, SarA [48292] (1 species)
   closely related to SarR but adopts a different fold; possible experimental artifact?

7. Species Staphylococcus aureus [TaxId:1280] [48293] (3 PDB entries)

8. Domain d2fnpa1: 2fnp A:103-224 [133825]

Details for d2fnpa1

PDB Entry: 2fnp, 2.6 Å

PDB Description: Crystal structure of SarA

PDB Compounds: (A:) Staphylococcal accessory regulator A

SCOPe Domain Sequences for d2fnpa1:

Sequence; same for both SEQRES and ATOM records:

>d2fnpa1 a.4.5.28 (A:103-224) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]}
itkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyyfkdiinhlny
kqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkriteannei
el

Timeline for d2fnpa1:

• d2fnpa1 first appeared in SCOP 1.73
  
• d2fnpa1 appears in SCOPe 2.07