SCOPe 2.08: Domain d2fnob2: 2fno B:3-87

Lineage for d2fnob2 (2fno B:3-87)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Hypothetical protein AGR_pAT_752p/Atu5508 [142361] (1 species)
   putative glutathione S-transferase

7. Species Agrobacterium tumefaciens [TaxId:358] [142362] (2 PDB entries)
   Uniprot Q7D2W7 1-87

8. Domain d2fnob2: 2fno B:3-87 [133824]
   Other proteins in same PDB: d2fnoa1, d2fnoa3, d2fnob1
   automated match to d2fnoa2
   complexed with scn

Details for d2fnob2

PDB Entry: 2fno, 2 Å

PDB Description: Crystal structure of a glutathione s-transferase (atu5508) from agrobacterium tumefaciens str. c58 at 2.00 A resolution

PDB Compounds: (B:) AGR_pAT_752p

SCOPe Domain Sequences for d2fnob2:

Sequence; same for both SEQRES and ATOM records:

>d2fnob2 c.47.1.5 (B:3-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]}
dgmntfdlyywpvpfrgqlirgilahcgcswdehdvdaieglmdcgaekqpvafmgppvl
idrernfaisqmpaiaiylgerldi

Timeline for d2fnob2:

• d2fnob2 first appeared in SCOP 1.73
  
• d2fnob2 appears in SCOPe 2.07