Lineage for d2fnob2 (2fno B:3-87)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2877237Protein Hypothetical protein AGR_pAT_752p/Atu5508 [142361] (1 species)
    putative glutathione S-transferase
  7. 2877238Species Agrobacterium tumefaciens [TaxId:358] [142362] (2 PDB entries)
    Uniprot Q7D2W7 1-87
  8. 2877242Domain d2fnob2: 2fno B:3-87 [133824]
    Other proteins in same PDB: d2fnoa1, d2fnoa3, d2fnob1
    automated match to d2fnoa2
    complexed with scn

Details for d2fnob2

PDB Entry: 2fno (more details), 2 Å

PDB Description: Crystal structure of a glutathione s-transferase (atu5508) from agrobacterium tumefaciens str. c58 at 2.00 A resolution
PDB Compounds: (B:) AGR_pAT_752p

SCOPe Domain Sequences for d2fnob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnob2 c.47.1.5 (B:3-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]}
dgmntfdlyywpvpfrgqlirgilahcgcswdehdvdaieglmdcgaekqpvafmgppvl
idrernfaisqmpaiaiylgerldi

SCOPe Domain Coordinates for d2fnob2:

Click to download the PDB-style file with coordinates for d2fnob2.
(The format of our PDB-style files is described here.)

Timeline for d2fnob2: