SCOPe 2.08: Domain d2fnoa1: 2fno A:88-236

Lineage for d2fnoa1 (2fno A:88-236)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Hypothetical protein AGR_pAT_752p/Atu5508 [140558] (1 species)
   putative glutathione S-transferase

7. Species Agrobacterium tumefaciens [TaxId:358] [140559] (2 PDB entries)
   Uniprot Q7D2W7 88-236

8. Domain d2fnoa1: 2fno A:88-236 [133821]
   Other proteins in same PDB: d2fnoa2, d2fnoa3, d2fnob2
   complexed with scn

Details for d2fnoa1

PDB Entry: 2fno, 2 Å

PDB Description: Crystal structure of a glutathione s-transferase (atu5508) from agrobacterium tumefaciens str. c58 at 2.00 A resolution

PDB Compounds: (A:) AGR_pAT_752p

SCOPe Domain Sequences for d2fnoa1:

Sequence; same for both SEQRES and ATOM records:

>d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]}
lpatvegrtlsakivndandvldeltlnggremwtpekwqefvprlqkwirifadtgarn
glsaasgfmlgtekigvadivtailwttvadrfpaikgiiedtspiiwglsrrvvatapl
aalnsksfeeygnaycggeiekslrkvas

Timeline for d2fnoa1:

• d2fnoa1 first appeared in SCOP 1.73
  
• d2fnoa1 appears in SCOPe 2.07