SCOP 1.73: Domain d2fnjc1: 2fnj C:17-112

Lineage for d2fnjc1 (2fnj C:17-112)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (2 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)

6. Protein Elongin C [54699] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54700] (6 PDB entries)

8. Domain d2fnjc1: 2fnj C:17-112 [133820]
   Other proteins in same PDB: d2fnja1, d2fnjb1
   automatically matched to d1lm8c_

Details for d2fnjc1

PDB Entry: 2fnj, 1.8 Å

PDB Description: crystal structure of a b30.2/spry domain-containing protein gustavus in complex with elongin b and elongin c

PDB Compounds: (C:) Transcription elongation factor B polypeptide 1

SCOP Domain Sequences for d2fnjc1:

Sequence, based on SEQRES records:

>d2fnjc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records):

>d2fnjc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpnevnfreipshvlskvcmyftykvryt
nssteipefpiapeialellmaanfldc

Timeline for d2fnjc1:

• d2fnjc1 is new in SCOP 1.73
  
• d2fnjc1 appears in SCOP 1.75
  
• d2fnjc1 appears in the current release, SCOPe 2.08, called d2fnjc_