SCOP 1.73: Domain d2fnja1: 2fnj A:35-251

Lineage for d2fnja1 (2fnj A:35-251)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.22: SPRY domain [141154] (3 proteins)
   Pfam PF00622

6. Protein LD34464p [141155] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [141156] (1 PDB entry)
   Cg2944-pf, isoform f

8. Domain d2fnja1: 2fnj A:35-251 [133818]
   Other proteins in same PDB: d2fnjb1, d2fnjc1

Details for d2fnja1

PDB Entry: 2fnj, 1.8 Å

PDB Description: crystal structure of a b30.2/spry domain-containing protein gustavus in complex with elongin b and elongin c

PDB Compounds: (A:) CG2944-PF, isoform F

SCOP Domain Sequences for d2fnja1:

Sequence; same for both SEQRES and ATOM records:

>d2fnja1 b.29.1.22 (A:35-251) LD34464p {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
fvkparidilldmppasrdlqlkhswnsedrslnifvkeddkltfhrhpvaqstdcirgk
vgltkglhiweiywptrqrgthavvgvctadaplhsvgyqslvgsteqswgwdlgrnkly
hdskncagvtypailkndeaflvpdkflvaldmdegtlsfivdqqylgiafrglrgkkly
pivsavwghceitmryiggldpeplplmdlcrrtirq

Timeline for d2fnja1:

• d2fnja1 is new in SCOP 1.73
  
• d2fnja1 appears in SCOP 1.75
  
• d2fnja1 appears in the current release, SCOPe 2.08