Lineage for d2fnib1 (2fni B:2-372)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705854Family c.67.1.4: GABA-aminotransferase-like [53417] (16 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 706104Protein Spore coat polysaccharide biosynthesis protein C [142672] (1 species)
  7. 706105Species Helicobacter pylori [TaxId:210] [142673] (3 PDB entries)
  8. 706111Domain d2fnib1: 2fni B:2-372 [133817]
    automatically matched to 2FN6 A:2-372
    complexed with plp

Details for d2fnib1

PDB Entry: 2fni (more details), 3 Å

PDB Description: PseC aminotransferase involved in pseudoaminic acid biosynthesis
PDB Compounds: (B:) aminotransferase

SCOP Domain Sequences for d2fnib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnib1 c.67.1.4 (B:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]}
kefaysepcldkedkkavlevlnskqltqgkrsllfeealceflgvkhalvfnsatsall
tlyrnfsefsadrneiittpisfvatanmllesgytpvfagikndgnidelalekliner
tkaivsvdyagksvevesvqklckkhslsflsdsshalgseyqnkkvggfalasvfsfha
ikpittaeggavvtndselhekmklfrshgmlkkdffegevksighnfrlneiqsalgls
qlkkapflmqkreeaaltydrifkdnpyftplhpllkdkssnhlypilmhqkfftckkli
leslhkrgilaqvhykpiyqyqlyqqlfntaplksaedfyhaeislpchanlnlesvqni
ahsvlktfesf

SCOP Domain Coordinates for d2fnib1:

Click to download the PDB-style file with coordinates for d2fnib1.
(The format of our PDB-style files is described here.)

Timeline for d2fnib1: