SCOPe 2.08: Domain d2fnib_: 2fni B:

Lineage for d2fnib_ (2fni B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein Spore coat polysaccharide biosynthesis protein C [142672] (1 species)

7. Species Helicobacter pylori [TaxId:210] [142673] (3 PDB entries)
   Uniprot O25130 2-372

8. Domain d2fnib_: 2fni B: [133817]
   automated match to d2fnub_
   complexed with plp

Details for d2fnib_

PDB Entry: 2fni, 3 Å

PDB Description: PseC aminotransferase involved in pseudoaminic acid biosynthesis

PDB Compounds: (B:) aminotransferase

SCOPe Domain Sequences for d2fnib_:

Sequence; same for both SEQRES and ATOM records:

>d2fnib_ c.67.1.4 (B:) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]}
mkefaysepcldkedkkavlevlnskqltqgkrsllfeealceflgvkhalvfnsatsal
ltlyrnfsefsadrneiittpisfvatanmllesgytpvfagikndgnidelalekline
rtkaivsvdyagksvevesvqklckkhslsflsdsshalgseyqnkkvggfalasvfsfh
aikpittaeggavvtndselhekmklfrshgmlkkdffegevksighnfrlneiqsalgl
sqlkkapflmqkreeaaltydrifkdnpyftplhpllkdkssnhlypilmhqkfftckkl
ileslhkrgilaqvhykpiyqyqlyqqlfntaplksaedfyhaeislpchanlnlesvqn
iahsvlktfesfki

Timeline for d2fnib_:

• d2fnib_ first appeared in SCOP 1.73, called d2fnib1
  
• d2fnib_ appears in SCOPe 2.07