SCOP 1.73: Domain d2fnia1: 2fni A:2-372

Lineage for d2fnia1 (2fni A:2-372)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (8 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (16 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein Spore coat polysaccharide biosynthesis protein C [142672] (1 species)

7. Species Helicobacter pylori [TaxId:210] [142673] (3 PDB entries)

8. Domain d2fnia1: 2fni A:2-372 [133816]
   automatically matched to 2FN6 A:2-372
   complexed with plp

Details for d2fnia1

PDB Entry: 2fni, 3 Å

PDB Description: PseC aminotransferase involved in pseudoaminic acid biosynthesis

PDB Compounds: (A:) aminotransferase

SCOP Domain Sequences for d2fnia1:

Sequence; same for both SEQRES and ATOM records:

>d2fnia1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]}
kefaysepcldkedkkavlevlnskqltqgkrsllfeealceflgvkhalvfnsatsall
tlyrnfsefsadrneiittpisfvatanmllesgytpvfagikndgnidelalekliner
tkaivsvdyagksvevesvqklckkhslsflsdsshalgseyqnkkvggfalasvfsfha
ikpittaeggavvtndselhekmklfrshgmlkkdffegevksighnfrlneiqsalgls
qlkkapflmqkreeaaltydrifkdnpyftplhpllkdkssnhlypilmhqkfftckkli
leslhkrgilaqvhykpiyqyqlyqqlfntaplksaedfyhaeislpchanlnlesvqni
ahsvlktfesf

Timeline for d2fnia1:

• d2fnia1 is new in SCOP 1.73
  
• d2fnia1 appears in SCOP 1.75
  
• d2fnia1 appears in the current release, SCOPe 2.08, called d2fnia_