Lineage for d2fnea1 (2fne A:1955-2042)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. Protein Multiple PDZ domain protein [141267] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [141268] (4 PDB entries)
    Uniprot Q5VZ62 1138-1243! Uniprot Q5VZ62 1955-2042
  8. Domain d2fnea1: 2fne A:1955-2042 [133813]
    Other proteins in same PDB: d2fnea2, d2fneb3, d2fneb4, d2fnec3, d2fnec4
    PDZ 13

Details for d2fnea1

PDB Entry: 2fne (more details), 1.83 Å

PDB Description: The crystal structure of the 13th PDZ domain of MPDZ
PDB Compounds: (A:) Multiple PDZ domain protein

SCOPe Domain Sequences for d2fnea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]}
pqcksitlergpdglgfsivggygsphgdlpiyvktvfakgaasedgrlkrgdqiiavng
qslegvtheeavailkrtkgtvtlmvls

SCOPe Domain Coordinates for d2fnea1 are not available.

Timeline for d2fnea1:

Domains from same chain:
(mouse over for more information)
d2fnea2
Domains from other chains:
(mouse over for more information)
d2fneb2, d2fneb3, d2fneb4, d2fnec2, d2fnec3, d2fnec4