Lineage for d2fnaa2 (2fna A:1-283)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479032Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2479057Protein Archaeal ATPase SSO1545 [142326] (1 species)
    member of Pfam PF01637 family; overall structural similarity to the archael CDC6-like protein APE0102
  7. 2479058Species Sulfolobus solfataricus [TaxId:2287] [142327] (1 PDB entry)
    Uniprot Q97Y08 1-283
  8. 2479059Domain d2fnaa2: 2fna A:1-283 [133810]
    Other proteins in same PDB: d2fnaa1, d2fnaa3, d2fnab1, d2fnab3
    complexed with adp, edo, mg

Details for d2fnaa2

PDB Entry: 2fna (more details), 2 Å

PDB Description: Crystal structure of an archaeal aaa+ atpase (sso1545) from sulfolobus solfataricus p2 at 2.00 A resolution
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2fnaa2:

Sequence, based on SEQRES records: (download)

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}
mlfdtspkdnrkdffdrekeieklkglrapitlvlglrrtgkssiikiginelnlpyiyl
dlrkfeernyisykdfllelqkeinklvkrlpsllkalkniqgivimgneikfnwnrkdr
lsfanllesfeqaskdnviivldeaqelvklrgvnllpalayaydnlkrikfimsgsemg
llydylrvedpesplfgrafstvelkpfsreeaieflrrgfqeadidfkdyevvyekigg
ipgwltyfgfiyldnknldfainqtleyakklilkefenflhg

Sequence, based on observed residues (ATOM records): (download)

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}
mlfdtspkdnrkdffdrekeieklkglrapitlvlglrrtgkssiikiginelnlpyiyl
dlrkfeernyisykdfllelqkeinklvkrlpsllkalkniqgivimgneikfnrlsfan
llesfeqaskdnviivldeaqelvklrgvnllpalayaydnlkrikfimsgsemgllydy
lrvedpesplfgrafstvelkpfsreeaieflrrgfqeadidfkdyevvyekiggipgwl
tyfgfiyldnknldfainqtleyakklilkefenflhg

SCOPe Domain Coordinates for d2fnaa2:

Click to download the PDB-style file with coordinates for d2fnaa2.
(The format of our PDB-style files is described here.)

Timeline for d2fnaa2: