SCOPe 2.08: Domain d2fnaa2: 2fna A:1-283

Lineage for d2fnaa2 (2fna A:1-283)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Archaeal ATPase SSO1545 [142326] (1 species)
   member of Pfam PF01637 family; overall structural similarity to the archael CDC6-like protein APE0102

7. Species Sulfolobus solfataricus [TaxId:2287] [142327] (1 PDB entry)
   Uniprot Q97Y08 1-283

8. Domain d2fnaa2: 2fna A:1-283 [133810]
   Other proteins in same PDB: d2fnaa1, d2fnaa3, d2fnab1, d2fnab3
   complexed with adp, edo, mg

Details for d2fnaa2

PDB Entry: 2fna, 2 Å

PDB Description: Crystal structure of an archaeal aaa+ atpase (sso1545) from sulfolobus solfataricus p2 at 2.00 A resolution

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2fnaa2:

Sequence, based on SEQRES records:

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}
mlfdtspkdnrkdffdrekeieklkglrapitlvlglrrtgkssiikiginelnlpyiyl
dlrkfeernyisykdfllelqkeinklvkrlpsllkalkniqgivimgneikfnwnrkdr
lsfanllesfeqaskdnviivldeaqelvklrgvnllpalayaydnlkrikfimsgsemg
llydylrvedpesplfgrafstvelkpfsreeaieflrrgfqeadidfkdyevvyekigg
ipgwltyfgfiyldnknldfainqtleyakklilkefenflhg

Sequence, based on observed residues (ATOM records):

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}
mlfdtspkdnrkdffdrekeieklkglrapitlvlglrrtgkssiikiginelnlpyiyl
dlrkfeernyisykdfllelqkeinklvkrlpsllkalkniqgivimgneikfnrlsfan
llesfeqaskdnviivldeaqelvklrgvnllpalayaydnlkrikfimsgsemgllydy
lrvedpesplfgrafstvelkpfsreeaieflrrgfqeadidfkdyevvyekiggipgwl
tyfgfiyldnknldfainqtleyakklilkefenflhg

Timeline for d2fnaa2:

• d2fnaa2 first appeared in SCOP 1.73
  
• d2fnaa2 appears in SCOPe 2.07