Lineage for d2fn6b_ (2fn6 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896358Protein Spore coat polysaccharide biosynthesis protein C [142672] (1 species)
  7. 2896359Species Helicobacter pylori [TaxId:210] [142673] (3 PDB entries)
    Uniprot O25130 2-372
  8. 2896363Domain d2fn6b_: 2fn6 B: [133808]
    automated match to d2fn6a1
    complexed with po4

Details for d2fn6b_

PDB Entry: 2fn6 (more details), 2.48 Å

PDB Description: Helicobacter pylori PseC, aminotransferase involved in the biosynthesis of pseudoaminic acid
PDB Compounds: (B:) aminotransferase

SCOPe Domain Sequences for d2fn6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fn6b_ c.67.1.4 (B:) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]}
kefaysepcldkedkkavlevlnskqltqgkrsllfeealceflgvkhalvfnsatsall
tlyrnfsefsadrneiittpisfvatanmllesgytpvfagikndgnidelalekliner
tkaivsvdyagksvevesvqklckkhslsflsdsshalgseyqnkkvggfalasvfsfha
ikpittaeggavvtndselhekmklfrshgmlkkdffegevksighnfrlneiqsalgls
qlkkapflmqkreeaaltydrifkdnpyftplhpllkdkssnhlypilmhqkfftckkli
leslhkrgilaqvhykpiyqyqlyqqlfntaplksaedfyhaeislpchanlnlesvqni
ahsvlktfesf

SCOPe Domain Coordinates for d2fn6b_:

Click to download the PDB-style file with coordinates for d2fn6b_.
(The format of our PDB-style files is described here.)

Timeline for d2fn6b_: