![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
![]() | Protein Spore coat polysaccharide biosynthesis protein C [142672] (1 species) |
![]() | Species Helicobacter pylori [TaxId:210] [142673] (3 PDB entries) Uniprot O25130 2-372 |
![]() | Domain d2fn6b_: 2fn6 B: [133808] automated match to d2fn6a1 complexed with po4 |
PDB Entry: 2fn6 (more details), 2.48 Å
SCOPe Domain Sequences for d2fn6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fn6b_ c.67.1.4 (B:) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} kefaysepcldkedkkavlevlnskqltqgkrsllfeealceflgvkhalvfnsatsall tlyrnfsefsadrneiittpisfvatanmllesgytpvfagikndgnidelalekliner tkaivsvdyagksvevesvqklckkhslsflsdsshalgseyqnkkvggfalasvfsfha ikpittaeggavvtndselhekmklfrshgmlkkdffegevksighnfrlneiqsalgls qlkkapflmqkreeaaltydrifkdnpyftplhpllkdkssnhlypilmhqkfftckkli leslhkrgilaqvhykpiyqyqlyqqlfntaplksaedfyhaeislpchanlnlesvqni ahsvlktfesf
Timeline for d2fn6b_: