Lineage for d2fn4a1 (2fn4 A:24-196)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846448Protein r-Ras [142273] (1 species)
  7. 1846449Species Human (Homo sapiens) [TaxId:9606] [142274] (1 PDB entry)
    Uniprot P10301 24-196
  8. 1846450Domain d2fn4a1: 2fn4 A:24-196 [133806]
    complexed with gdp, mg

Details for d2fn4a1

PDB Entry: 2fn4 (more details), 1.65 Å

PDB Description: The crystal structure of human Ras-related protein, RRAS, in the GDP-bound state
PDB Compounds: (A:) Ras-related protein R-Ras

SCOPe Domain Sequences for d2fn4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]}
pppsethklvvvggggvgksaltiqfiqsyfvsdydptiedsytkicsvdgiparldild
tagqeefgamreqymraghgfllvfaindrqsfnevgklftqilrvkdrddfpvvlvgnk
adlesqrqvprseasafgashhvayfeasaklrlnvdeafeqlvravrkyqeq

SCOPe Domain Coordinates for d2fn4a1:

Click to download the PDB-style file with coordinates for d2fn4a1.
(The format of our PDB-style files is described here.)

Timeline for d2fn4a1: