Lineage for d2fn1b1 (2fn1 B:2-434)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736993Fold d.161: ADC synthase [56321] (1 superfamily)
    duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets
  4. 736994Superfamily d.161.1: ADC synthase [56322] (1 family) (S)
    the active site is formed by additional structures inserted into the core structure
  5. 736995Family d.161.1.1: ADC synthase [56323] (5 proteins)
  6. 737023Protein Salicylate synthetase Irp9 [143943] (1 species)
  7. 737024Species Yersinia enterocolitica [TaxId:630] [143944] (2 PDB entries)
  8. 737028Domain d2fn1b1: 2fn1 B:2-434 [133802]
    automatically matched to 2FN0 A:2-434
    complexed with mg, pyr, sal

Details for d2fn1b1

PDB Entry: 2fn1 (more details), 2.1 Å

PDB Description: Crystal structures of Yersinia enterocolitica salicylate synthase (Irp9) in complex with the reaction products salicylate and pyruvate
PDB Compounds: (B:) salicylate synthetase, Irp9

SCOP Domain Sequences for d2fn1b1:

Sequence, based on SEQRES records: (download)

>d2fn1b1 d.161.1.1 (B:2-434) Salicylate synthetase Irp9 {Yersinia enterocolitica [TaxId: 630]}
kiseflhlalpeeqwlptisgvlrqfaeeecyvyerppcwylgkgcqarlhinadgtqat
fiddageqkwavdsiadcarrfmahpqvkgrrvygqvgfnfaahargiafnagewplltl
tvpreelifekgnvtvyadsadgcrrlcewvkeastttqnaplavdtalngeaykqqvar
avaeirrgeyvkvivsraiplpsridmpatllygrqantpvrsfmfrqegrealgfspel
vmsvtgnkvvteplagtrdrmgnpehnkakeaellhdskevlehilsvkeaiaeleavcl
pgsvvvedlmsvrqrgsvqhlgsgvsgqlaenkdawdaftvlfpsitasgipknaalnai
mqiektprelysgailllddtrfdaalvlrsvfqdsqrcwiqagagiiaqstpereltet
reklasiapylmv

Sequence, based on observed residues (ATOM records): (download)

>d2fn1b1 d.161.1.1 (B:2-434) Salicylate synthetase Irp9 {Yersinia enterocolitica [TaxId: 630]}
kiseflhlalpeeqwlptisgvlrqfaeeecyvyerppcwylgkgcqarlhinadgtqat
fiddageqkwavdsiadcarrfmahpqvkgrrvygqvgfnfaahargiafnagewplltl
tvpreelifekgnvtvyadplavdtalngeaykqqvaravaeirrgeyvkvivsraiplp
sridmpatllygrqantpvrsfmfrqegrealgfspelvmsvtgnkvvteplagtrdrmg
npehnkakeaellhdskevlehilsvkeaiaeleavclpgsvvvedlmsvrqrgsvqhlg
sgvsgqlaenkdawdaftvlfpsitasgipknaalnaimqiektprelysgailllddtr
fdaalvlrsvfqdsqrcwiqagagiiaqstpereltetreklasiapylmv

SCOP Domain Coordinates for d2fn1b1:

Click to download the PDB-style file with coordinates for d2fn1b1.
(The format of our PDB-style files is described here.)

Timeline for d2fn1b1: