Lineage for d2fmxb1 (2fmx B:13-198)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 696345Protein SAR1 [69483] (3 species)
  7. 696349Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [69484] (2 PDB entries)
  8. 696353Domain d2fmxb1: 2fmx B:13-198 [133797]
    automatically matched to d1f6ba_
    complexed with gdp, mg, so4

Details for d2fmxb1

PDB Entry: 2fmx (more details), 1.82 Å

PDB Description: An open conformation of switch I revealed by Sar1-GDP crystal structure at low Mg(2+)
PDB Compounds: (B:) GTP-binding protein SAR1b

SCOP Domain Sequences for d2fmxb1:

Sequence, based on SEQRES records: (download)

>d2fmxb1 c.37.1.8 (B:13-198) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
ssvlqflglykktgklvflgldnagkttllhmlkddrlgqhvptlhptseeltiagmtft
tfdlgghiqarrvwknylpaingivflvdcadherlleskeeldslmtdetianvpilil
gnkidrpeaiseerlremfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrw
maqyid

Sequence, based on observed residues (ATOM records): (download)

>d2fmxb1 c.37.1.8 (B:13-198) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
ssvlqflglykktgklvflgldnagkttllhmlkdptlhptseeltiagmtfttfdlgvw
knylpaingivflvdcadherlleskeeldslmtdetianvpililgnkidrpeaiseer
lremfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrwmaqyid

SCOP Domain Coordinates for d2fmxb1:

Click to download the PDB-style file with coordinates for d2fmxb1.
(The format of our PDB-style files is described here.)

Timeline for d2fmxb1: