Lineage for d2fmua1 (2fmu A:7-236)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842820Protein TAT-interacting protein TIP30 [141904] (2 species)
  7. 2842823Species Mouse (Mus musculus) [TaxId:10090] [141906] (1 PDB entry)
    Uniprot Q9Z2G9 7-236
  8. 2842824Domain d2fmua1: 2fmu A:7-236 [133795]
    Other proteins in same PDB: d2fmua2
    complexed with edo

Details for d2fmua1

PDB Entry: 2fmu (more details), 2.3 Å

PDB Description: crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution
PDB Compounds: (A:) HIV-1 tat interactive protein 2, 30 kDa homolog

SCOPe Domain Sequences for d2fmua1:

Sequence, based on SEQRES records: (download)

>d2fmua1 c.2.1.2 (A:7-236) TAT-interacting protein TIP30 {Mouse (Mus musculus) [TaxId: 10090]}
lpklredfkmqnksvfilgasgetgkvllkeilgqnlfskvtligrrkltfeeeayknvn
qevvdfekldvyasafqghdvgfcclgttrskagaegfvrvdrdyvlksaelakaggckh
fnllssrgadksssflylqvkgeveakveelkfdrlsvfrpgvllcdrqesrpgewlark
ffgslpdswasgyavpvvtvvramlnnlvspssgqmellenkailhlgkd

Sequence, based on observed residues (ATOM records): (download)

>d2fmua1 c.2.1.2 (A:7-236) TAT-interacting protein TIP30 {Mouse (Mus musculus) [TaxId: 10090]}
lpklredfkmqnksvfilgasgetgkvllkeilgqnlfskvtligrrkltfyknvnqevv
dfekldvyasafqghdvgfcclgtkagaegfvrvdrdyvlksaelakaggckhfnllssr
gadksssflylqvkgeveakveelkfdrlsvfrpgvllcdswasgyavpvvtvvramlnn
lvspssgqmellenkailhlgkd

SCOPe Domain Coordinates for d2fmua1:

Click to download the PDB-style file with coordinates for d2fmua1.
(The format of our PDB-style files is described here.)

Timeline for d2fmua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fmua2