Lineage for d2fmpa3 (2fmp A:149-335)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740075Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 740076Superfamily d.218.1: Nucleotidyltransferase [81301] (11 families) (S)
  5. 740084Family d.218.1.2: DNA polymerase beta-like [81300] (4 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 740085Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 740086Species Human (Homo sapiens) [TaxId:9606] [81574] (103 PDB entries)
  8. 740087Domain d2fmpa3: 2fmp A:149-335 [133788]
    Other proteins in same PDB: d2fmpa1, d2fmpa2
    automatically matched to d1bpxa4
    complexed with dct, doc, mg, na

Details for d2fmpa3

PDB Entry: 2fmp (more details), 1.65 Å

PDB Description: DNA Polymerase beta with a terminated gapped DNA substrate and ddCTP with sodium in the catalytic site
PDB Compounds: (A:) DNA polymerase beta

SCOP Domain Sequences for d2fmpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmpa3 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

SCOP Domain Coordinates for d2fmpa3:

Click to download the PDB-style file with coordinates for d2fmpa3.
(The format of our PDB-style files is described here.)

Timeline for d2fmpa3: