Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
Protein Heterochromatin protein 1, HP1 [54166] (4 species) duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain |
Species Human (Homo sapiens) [TaxId:9606] [187099] (3 PDB entries) |
Domain d2fmmd_: 2fmm D: [133785] Other proteins in same PDB: d2fmme1, d2fmme2 automated match to d1s4za_ complexed with so4 |
PDB Entry: 2fmm (more details), 1.8 Å
SCOPe Domain Sequences for d2fmmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fmmd_ b.34.13.2 (D:) Heterochromatin protein 1, HP1 {Human (Homo sapiens) [TaxId: 9606]} prgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerlt whsyps
Timeline for d2fmmd_: