SCOPe 2.07: Domain d2fmmd_: 2fmm D:

Lineage for d2fmmd_ (2fmm D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein Heterochromatin protein 1, HP1 [54166] (4 species)
   duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain

7. Species Human (Homo sapiens) [TaxId:9606] [187099] (3 PDB entries)

8. Domain d2fmmd_: 2fmm D: [133785]
   Other proteins in same PDB: d2fmme1, d2fmme2
   automated match to d1s4za_
   complexed with so4

Details for d2fmmd_

PDB Entry: 2fmm, 1.8 Å

PDB Description: Crystal Structure of EMSY-HP1 complex

PDB Compounds: (D:) chromobox protein homolog 1

SCOPe Domain Sequences for d2fmmd_:

Sequence; same for both SEQRES and ATOM records:

>d2fmmd_ b.34.13.2 (D:) Heterochromatin protein 1, HP1 {Human (Homo sapiens) [TaxId: 9606]}
prgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerlt
whsyps

Timeline for d2fmmd_:

• d2fmmd_ first appeared in SCOP 1.73, called d2fmmd1
  
• d2fmmd_ appears in SCOPe 2.06
  
• d2fmmd_ appears in the current release, SCOPe 2.08