Lineage for d2fmmd_ (2fmm D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 947418Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 947452Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 947497Protein Heterochromatin protein 1, HP1 [54166] (4 species)
    duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain
  7. 947505Species Human (Homo sapiens) [TaxId:9606] [187099] (1 PDB entry)
  8. 947509Domain d2fmmd_: 2fmm D: [133785]
    Other proteins in same PDB: d2fmme1
    automated match to d1s4za_
    complexed with so4

Details for d2fmmd_

PDB Entry: 2fmm (more details), 1.8 Å

PDB Description: Crystal Structure of EMSY-HP1 complex
PDB Compounds: (D:) chromobox protein homolog 1

SCOPe Domain Sequences for d2fmmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmmd_ b.34.13.2 (D:) Heterochromatin protein 1, HP1 {Human (Homo sapiens) [TaxId: 9606]}
prgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerlt
whsyps

SCOPe Domain Coordinates for d2fmmd_:

Click to download the PDB-style file with coordinates for d2fmmd_.
(The format of our PDB-style files is described here.)

Timeline for d2fmmd_: