Lineage for d2fmmc1 (2fmm C:109-175)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 797173Superfamily b.34.13: Chromo domain-like [54160] (3 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 797197Family b.34.13.2: Chromo domain [54165] (7 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 797242Protein Heterochromatin protein 1, HP1 [54166] (3 species)
    duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain
  7. 797250Species Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId:10090] [54167] (5 PDB entries)
  8. 797253Domain d2fmmc1: 2fmm C:109-175 [133784]
    Other proteins in same PDB: d2fmme1
    automatically matched to d1s4za_
    complexed with so4

Details for d2fmmc1

PDB Entry: 2fmm (more details), 1.8 Å

PDB Description: Crystal Structure of EMSY-HP1 complex
PDB Compounds: (C:) chromobox protein homolog 1

SCOP Domain Sequences for d2fmmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmmc1 b.34.13.2 (C:109-175) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]}
kprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerl
twhsyps

SCOP Domain Coordinates for d2fmmc1:

Click to download the PDB-style file with coordinates for d2fmmc1.
(The format of our PDB-style files is described here.)

Timeline for d2fmmc1: