![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (3 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.2: Chromo domain [54165] (7 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
![]() | Protein Heterochromatin protein 1, HP1 [54166] (3 species) duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain |
![]() | Species Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId:10090] [54167] (5 PDB entries) |
![]() | Domain d2fmma1: 2fmm A:108-175 [133782] automatically matched to d1s4za_ complexed with so4 |
PDB Entry: 2fmm (more details), 1.8 Å
SCOP Domain Sequences for d2fmma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fmma1 b.34.13.2 (A:108-175) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} ekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeer ltwhsyps
Timeline for d2fmma1: