Lineage for d2fmlb2 (2fml B:4-204)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871095Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 871096Superfamily d.113.1: Nudix [55811] (7 families) (S)
  5. 871296Family d.113.1.6: BT0354 N-terminal domain-like [143772] (2 proteins)
    accosiated with the C-terminal "winged helix" domain ((46785))
    accosiated with the C-terminal "winged helix" domain ((46785))
  6. 871303Protein Hypothetical protein EF2700, N-terminal domain [143773] (1 species)
    includes extra N-terminal alpha-hairpin, separated by a linker peptide
  7. 871304Species Enterococcus faecalis [TaxId:1351] [143774] (1 PDB entry)
    Uniprot Q830S2 3-204
  8. 871306Domain d2fmlb2: 2fml B:4-204 [133781]
    Other proteins in same PDB: d2fmla1, d2fmlb1
    automatically matched to 2FML A:3-204
    complexed with gol

Details for d2fmlb2

PDB Entry: 2fml (more details), 2.26 Å

PDB Description: Crystal structure of MutT/nudix family protein from Enterococcus faecalis
PDB Compounds: (B:) MutT/nudix family protein

SCOP Domain Sequences for d2fmlb2:

Sequence, based on SEQRES records: (download)

>d2fmlb2 d.113.1.6 (B:4-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]}
faskaeeknyyerqaslaefltwyhqqelpeyekpsltvdmvllcynkeadqlkvlliqr
kghpfrnswalpggfvnrnestedsvlretkeetgvvisqenieqlhsfsrpdrdprgwv
vtvsylafigeepliagddakevhwfnlerhgqhitlshedveitldlktaaslgkdtla
fdhseiiikafnrvvdkmehe

Sequence, based on observed residues (ATOM records): (download)

>d2fmlb2 d.113.1.6 (B:4-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]}
faskaeeknyyerqaslaefltwyhqqyekpsltvdmvllcynkeadqlkvlliqrkghp
frnswalpggfvnrnestedsvlretkeetgvvisqenieqlhsfsrpdrdprgwvvtvs
ylafigeepliagddakevhwfnlerhgqhitlshedveitldlktaaslgkdtlafdhs
eiiikafnrvvdkmehe

SCOP Domain Coordinates for d2fmlb2:

Click to download the PDB-style file with coordinates for d2fmlb2.
(The format of our PDB-style files is described here.)

Timeline for d2fmlb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fmlb1