Lineage for d2fmlb1 (2fml B:205-269)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984034Family a.4.5.68: Nudix-associated domain [140299] (2 proteins)
    PfamB PB002148; this domain is C-terminal to the Nudix domain in some bacterial proteins
  6. 1984044Protein Hypothetical protein EF2700, C-terminal domain [140302] (1 species)
  7. 1984045Species Enterococcus faecalis [TaxId:1351] [140303] (1 PDB entry)
    Uniprot Q830S2 205-268
  8. 1984047Domain d2fmlb1: 2fml B:205-269 [133780]
    Other proteins in same PDB: d2fmla2, d2fmlb2
    automated match to d2fmla1
    complexed with gol

Details for d2fmlb1

PDB Entry: 2fml (more details), 2.26 Å

PDB Description: Crystal structure of MutT/nudix family protein from Enterococcus faecalis
PDB Compounds: (B:) MutT/nudix family protein

SCOPe Domain Sequences for d2fmlb1:

Sequence, based on SEQRES records: (download)

>d2fmlb1 a.4.5.68 (B:205-269) Hypothetical protein EF2700, C-terminal domain {Enterococcus faecalis [TaxId: 1351]}
pqvlqvlgkdftitearkvfakflgvdyrsidhsnfkkamtqyfeelgerpvgigrpski
yqlkt

Sequence, based on observed residues (ATOM records): (download)

>d2fmlb1 a.4.5.68 (B:205-269) Hypothetical protein EF2700, C-terminal domain {Enterococcus faecalis [TaxId: 1351]}
pqvlqvlgkdftitearkvfakflgvdyrsidhsnfkkamtqyfeelgerpskiyqlkt

SCOPe Domain Coordinates for d2fmlb1:

Click to download the PDB-style file with coordinates for d2fmlb1.
(The format of our PDB-style files is described here.)

Timeline for d2fmlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fmlb2