Lineage for d2fmla2 (2fml A:3-204)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1923249Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1923250Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1923517Family d.113.1.6: BT0354 N-terminal domain-like [143772] (3 proteins)
    accosiated with the C-terminal "winged helix" domain (46785)
  6. 1923524Protein Hypothetical protein EF2700, N-terminal domain [143773] (1 species)
    includes extra N-terminal alpha-hairpin, separated by a linker peptide
  7. 1923525Species Enterococcus faecalis [TaxId:1351] [143774] (1 PDB entry)
    Uniprot Q830S2 3-204
  8. 1923526Domain d2fmla2: 2fml A:3-204 [133779]
    Other proteins in same PDB: d2fmla1, d2fmlb1
    complexed with gol

Details for d2fmla2

PDB Entry: 2fml (more details), 2.26 Å

PDB Description: Crystal structure of MutT/nudix family protein from Enterococcus faecalis
PDB Compounds: (A:) MutT/nudix family protein

SCOPe Domain Sequences for d2fmla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]}
qfaskaeeknyyerqaslaefltwyhqqelpeyekpsltvdmvllcynkeadqlkvlliq
rkghpfrnswalpggfvnrnestedsvlretkeetgvvisqenieqlhsfsrpdrdprgw
vvtvsylafigeepliagddakevhwfnlerhgqhitlshedveitldlktaaslgkdtl
afdhseiiikafnrvvdkmehe

SCOPe Domain Coordinates for d2fmla2:

Click to download the PDB-style file with coordinates for d2fmla2.
(The format of our PDB-style files is described here.)

Timeline for d2fmla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fmla1