Lineage for d2fmka1 (2fmk A:2-129)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691581Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 691582Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 691596Protein CheY protein [52174] (4 species)
  7. 691655Species Salmonella typhimurium [TaxId:90371] [52176] (11 PDB entries)
  8. 691658Domain d2fmka1: 2fmk A:2-129 [133777]
    automatically matched to d2che__
    complexed with ace, bef, mg

Details for d2fmka1

PDB Entry: 2fmk (more details), 2 Å

PDB Description: Crystal structure of Mg2+ and BeF3- bound CheY in complex with CheZ 200-214 solved from a P2(1)2(1)2 crystal grown in MES (pH 6.0)
PDB Compounds: (A:) Chemotaxis protein cheY

SCOP Domain Sequences for d2fmka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmka1 c.23.1.1 (A:2-129) CheY protein {Salmonella typhimurium [TaxId: 602]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

SCOP Domain Coordinates for d2fmka1:

Click to download the PDB-style file with coordinates for d2fmka1.
(The format of our PDB-style files is described here.)

Timeline for d2fmka1: