SCOPe 2.07: Domain d2fmia_: 2fmi A:

Lineage for d2fmia_ (2fmi A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Salmonella typhimurium [TaxId:90371] [52176] (13 PDB entries)

8. Domain d2fmia_: 2fmi A: [133776]
   automated match to d2che__
   complexed with gol, so4, trs

Details for d2fmia_

PDB Entry: 2fmi, 2.3 Å

PDB Description: Crystal structure of CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Tris (pH 8.4)

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d2fmia_:

Sequence; same for both SEQRES and ATOM records:

>d2fmia_ c.23.1.1 (A:) CheY protein {Salmonella typhimurium [TaxId: 90371]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d2fmia_:

• d2fmia_ first appeared in SCOP 1.73, called d2fmia1
  
• d2fmia_ appears in SCOPe 2.06
  
• d2fmia_ appears in the current release, SCOPe 2.08