Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (7 families) |
Family c.23.1.1: CheY-related [52173] (25 proteins) |
Protein CheY protein [52174] (4 species) |
Species Salmonella typhimurium [TaxId:90371] [52176] (11 PDB entries) |
Domain d2fmha1: 2fmh A:2-129 [133775] automatically matched to d2che__ complexed with bef, gol, mg, so4, trs |
PDB Entry: 2fmh (more details), 2 Å
SCOP Domain Sequences for d2fmha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fmha1 c.23.1.1 (A:2-129) CheY protein {Salmonella typhimurium [TaxId: 602]} adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln kifeklgm
Timeline for d2fmha1: