Lineage for d2fmfa_ (2fmf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855436Protein CheY protein [52174] (6 species)
  7. 2855514Species Salmonella typhimurium [TaxId:90371] [52176] (13 PDB entries)
  8. 2855518Domain d2fmfa_: 2fmf A: [133773]
    automated match to d2che__
    complexed with so4

Details for d2fmfa_

PDB Entry: 2fmf (more details), 2 Å

PDB Description: Crystal structure of CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Hepes (pH 7.5)
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d2fmfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmfa_ c.23.1.1 (A:) CheY protein {Salmonella typhimurium [TaxId: 90371]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d2fmfa_:

Click to download the PDB-style file with coordinates for d2fmfa_.
(The format of our PDB-style files is described here.)

Timeline for d2fmfa_: