Lineage for d2fmeb1 (2fme B:18-362)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 830794Family c.37.1.9: Motor proteins [52641] (4 proteins)
  6. 830795Protein Kinesin [52646] (7 species)
  7. 830799Species Human (Homo sapiens), mitotic kinesin eg5 [TaxId:9606] [64018] (17 PDB entries)
  8. 830817Domain d2fmeb1: 2fme B:18-362 [133772]
    automatically matched to d1q0bb_
    complexed with 3qc, adp, mg

Details for d2fmeb1

PDB Entry: 2fme (more details), 2.1 Å

PDB Description: crystal structure of the mitotic kinesin eg5 (ksp) in complex with mg- adp and (r)-4-(3-hydroxyphenyl)-n,n,7,8-tetramethyl-3,4- dihydroisoquinoline-2(1h)-carboxamide
PDB Compounds: (B:) Kinesin-like protein KIF11

SCOP Domain Sequences for d2fmeb1:

Sequence, based on SEQRES records: (download)

>d2fmeb1 c.37.1.9 (B:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]}
niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
igklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphvpyresklt
rilqdslggrtrtsiiatispaslnleetlstleyahraknilnk

Sequence, based on observed residues (ATOM records): (download)

>d2fmeb1 c.37.1.9 (B:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]}
niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggssrktytfdmvfgastkqidv
yrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiiprtlh
qifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviikglee
itvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvkigkl
nlvdlagsenigrinqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiia
tispaslnleetlstleyahraknilnk

SCOP Domain Coordinates for d2fmeb1:

Click to download the PDB-style file with coordinates for d2fmeb1.
(The format of our PDB-style files is described here.)

Timeline for d2fmeb1: