Lineage for d2fmea_ (2fme A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111709Protein automated matches [190129] (6 species)
    not a true protein
  7. 2111718Species Human (Homo sapiens) [TaxId:9606] [187145] (33 PDB entries)
  8. 2111752Domain d2fmea_: 2fme A: [133771]
    automated match to d1q0bb_
    complexed with 3qc, adp, mg

Details for d2fmea_

PDB Entry: 2fme (more details), 2.1 Å

PDB Description: crystal structure of the mitotic kinesin eg5 (ksp) in complex with mg- adp and (r)-4-(3-hydroxyphenyl)-n,n,7,8-tetramethyl-3,4- dihydroisoquinoline-2(1h)-carboxamide
PDB Compounds: (A:) Kinesin-like protein KIF11

SCOPe Domain Sequences for d2fmea_:

Sequence, based on SEQRES records: (download)

>d2fmea_ c.37.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgast
kqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagii
prtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvii
kgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelv
kigklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphvpyreskl
trilqdslggrtrtsiiatispaslnleetlstleyahraknilnkp

Sequence, based on observed residues (ATOM records): (download)

>d2fmea_ c.37.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggssrktytfdmvfgastkqid
vyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiiprtl
hqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviikgle
eitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkvkigklnlvdlags
enigrinqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiiatispasln
leetlstleyahraknilnkp

SCOPe Domain Coordinates for d2fmea_:

Click to download the PDB-style file with coordinates for d2fmea_.
(The format of our PDB-style files is described here.)

Timeline for d2fmea_: