SCOPe 2.07: Domain d2fm9a1: 2fm9 A:49-263

Lineage for d2fm9a1 (2fm9 A:49-263)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.257: SipA N-terminal domain-like [140745] (1 superfamily)
   multihelical; bundle; the last helix is buried inside the bundle

4. Superfamily a.257.1: SipA N-terminal domain-like [140746] (1 family)
   automatically mapped to Pfam PF09052

5. Family a.257.1.1: SipA N-terminal domain-like [140747] (1 protein)
   N-terminal part of Pfam PF09052

6. Protein Cell invasion protein SipA, N-terminal domain [140748] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [140749] (2 PDB entries)
   Uniprot Q56027 23-262! Uniprot Q56027 49-263

8. Domain d2fm9a1: 2fm9 A:49-263 [133770]

Details for d2fm9a1

PDB Entry: 2fm9, 2 Å

PDB Description: structure of salmonella sipa residues 48-264

PDB Compounds: (A:) Cell invasion protein sipA

SCOPe Domain Sequences for d2fm9a1:

Sequence, based on SEQRES records:

>d2fm9a1 a.257.1.1 (A:49-263) Cell invasion protein SipA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
pqledfpalikqasldalfkcgkdaealkevftnsnnvagkkaimefaglfrsalnatsd
speaktllmkvgaeytaqiikdglkeksafgpwlpetkkaeaklenlekqlldiiknntg
gelsklstnlvmqevmpyiasciehnfgctldpltrsnlthlvdkaaakavealdmchqk
ltqeqgtsvgrearhlemqtliplllrnvfaqipa

Sequence, based on observed residues (ATOM records):

>d2fm9a1 a.257.1.1 (A:49-263) Cell invasion protein SipA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
pqledfpalikqasldalfkcgkdaealkevftnsnnvagkkaimefaglfrsalnatsd
speaktllmkvgaeytaqiikdglkeksafgpwlpetkkaeaklenlekqlldiiknntg
gelsklstnlvmqevmpyiasciehnfgctldpltrsnlthlvdkaaakavealdmchqk
hlemqtliplllrnvfaqipa

Timeline for d2fm9a1:

• d2fm9a1 first appeared in SCOP 1.73
  
• d2fm9a1 appears in SCOPe 2.06
  
• d2fm9a1 appears in the current release, SCOPe 2.08