![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.257: SipA N-terminal domain-like [140745] (1 superfamily) multihelical; bundle; the last helix is buried inside the bundle |
![]() | Superfamily a.257.1: SipA N-terminal domain-like [140746] (1 family) ![]() automatically mapped to Pfam PF09052 |
![]() | Family a.257.1.1: SipA N-terminal domain-like [140747] (1 protein) N-terminal part of Pfam PF09052 |
![]() | Protein Cell invasion protein SipA, N-terminal domain [140748] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [140749] (2 PDB entries) Uniprot Q56027 23-262! Uniprot Q56027 49-263 |
![]() | Domain d2fm9a1: 2fm9 A:49-263 [133770] |
PDB Entry: 2fm9 (more details), 2 Å
SCOPe Domain Sequences for d2fm9a1:
Sequence, based on SEQRES records: (download)
>d2fm9a1 a.257.1.1 (A:49-263) Cell invasion protein SipA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} pqledfpalikqasldalfkcgkdaealkevftnsnnvagkkaimefaglfrsalnatsd speaktllmkvgaeytaqiikdglkeksafgpwlpetkkaeaklenlekqlldiiknntg gelsklstnlvmqevmpyiasciehnfgctldpltrsnlthlvdkaaakavealdmchqk ltqeqgtsvgrearhlemqtliplllrnvfaqipa
>d2fm9a1 a.257.1.1 (A:49-263) Cell invasion protein SipA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} pqledfpalikqasldalfkcgkdaealkevftnsnnvagkkaimefaglfrsalnatsd speaktllmkvgaeytaqiikdglkeksafgpwlpetkkaeaklenlekqlldiiknntg gelsklstnlvmqevmpyiasciehnfgctldpltrsnlthlvdkaaakavealdmchqk hlemqtliplllrnvfaqipa
Timeline for d2fm9a1: