Lineage for d2fm9a1 (2fm9 A:49-263)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016167Fold a.257: SipA N-terminal domain-like [140745] (1 superfamily)
    multihelical; bundle; the last helix is buried inside the bundle
  4. 2016168Superfamily a.257.1: SipA N-terminal domain-like [140746] (1 family) (S)
    automatically mapped to Pfam PF09052
  5. 2016169Family a.257.1.1: SipA N-terminal domain-like [140747] (1 protein)
    N-terminal part of Pfam PF09052
  6. 2016170Protein Cell invasion protein SipA, N-terminal domain [140748] (1 species)
  7. 2016171Species Salmonella typhimurium [TaxId:90371] [140749] (2 PDB entries)
    Uniprot Q56027 23-262! Uniprot Q56027 49-263
  8. 2016172Domain d2fm9a1: 2fm9 A:49-263 [133770]

Details for d2fm9a1

PDB Entry: 2fm9 (more details), 2 Å

PDB Description: structure of salmonella sipa residues 48-264
PDB Compounds: (A:) Cell invasion protein sipA

SCOPe Domain Sequences for d2fm9a1:

Sequence, based on SEQRES records: (download)

>d2fm9a1 a.257.1.1 (A:49-263) Cell invasion protein SipA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
pqledfpalikqasldalfkcgkdaealkevftnsnnvagkkaimefaglfrsalnatsd
speaktllmkvgaeytaqiikdglkeksafgpwlpetkkaeaklenlekqlldiiknntg
gelsklstnlvmqevmpyiasciehnfgctldpltrsnlthlvdkaaakavealdmchqk
ltqeqgtsvgrearhlemqtliplllrnvfaqipa

Sequence, based on observed residues (ATOM records): (download)

>d2fm9a1 a.257.1.1 (A:49-263) Cell invasion protein SipA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
pqledfpalikqasldalfkcgkdaealkevftnsnnvagkkaimefaglfrsalnatsd
speaktllmkvgaeytaqiikdglkeksafgpwlpetkkaeaklenlekqlldiiknntg
gelsklstnlvmqevmpyiasciehnfgctldpltrsnlthlvdkaaakavealdmchqk
hlemqtliplllrnvfaqipa

SCOPe Domain Coordinates for d2fm9a1:

Click to download the PDB-style file with coordinates for d2fm9a1.
(The format of our PDB-style files is described here.)

Timeline for d2fm9a1: